DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Prss36

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:254 Identity:86/254 - (33%)
Similarity:123/254 - (48%) Gaps:22/254 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHC-----VLEYSKPQYYVIR 86
            |...|||||.:.|...:|.||||..|..|.|||::|:|:.:|:||||     .||.:.....::.
Mouse    43 EPSSRIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADELSVLLG 107

  Fly    87 AGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTA 151
            ..|.|....|:::|....|..|:.:....:..|:|:::|..|......:||:.|..:..:.....
Mouse   108 VHSQDGPLEGAHMRSVATILIPDNYSTVELGADLALLRLASPAKLGPSVRPVCLPRASHLFAHGT 172

  Fly   152 QLFVSGWGSTSISQMQP------EKRLRYTVVHLRDQNQCARNYFGAGTVTNT------MFCAGT 204
            ..:.:|||....:...|      |..||     |..:..|...|...|....|      |.|||.
Mouse   173 ACWATGWGDVQEAVPLPLPWVLQEVELR-----LLGEAACQCLYSRPGPFNLTFQLLPGMLCAGY 232

  Fly   205 QAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTI 263
            .||.||:||||||||||....||..|.||.|:||||.....||::|.|:.|:.||.:.:
Mouse   233 PAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAPYESWIREHV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 83/244 (34%)
Tryp_SPc 32..262 CDD:238113 84/246 (34%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 84/246 (34%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.