DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:237 Identity:92/237 - (38%)
Similarity:134/237 - (56%) Gaps:15/237 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWT 93
            |.:||||:.......|:||||..|..|.|||::||...:|:||||   |.:.....:...:.|..
Mouse    21 DDKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLISDQWVLSAAHC---YKRRLQVRLGEHNIDVL 82

  Fly    94 KGG-SYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFVSG 157
            :|| .:|..:|||.||:::..| ::|||.:::|:.|.:.:..:..:||..|  .....||..|||
Mouse    83 EGGEQFIDAEKIIRHPDYNKDT-VDNDIMLIKLKSPAILNSQVSTVSLPRS--CASTNAQCLVSG 144

  Fly   158 WGST-SISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLV 221
            ||:| ||....| ..|:.....:...:.|.::|  .|.:|:.|||.|...||:|||.||||||:|
Mouse   145 WGNTVSIGGKYP-ALLQCLEAPVLSASSCKKSY--PGQITSNMFCLGFLEGGKDSCDGDSGGPVV 206

  Fly   222 TSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTI 263
              .:|.::  ||||||..||....||:||||..|..||.:|:
Mouse   207 --CNGEIQ--GIVSWGSVCAMRGKPGVYTKVCNYLSWIQETM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 88/229 (38%)
Tryp_SPc 32..262 CDD:238113 90/231 (39%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 88/229 (38%)
Tryp_SPc 24..243 CDD:238113 90/231 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.