DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Prss55

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:250 Identity:90/250 - (36%)
Similarity:127/250 - (50%) Gaps:28/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSK---PQYYVIRAGS 89
            |..||:.|.|..:..||.|||:|....|.|||:|:|...|||.|||.  |::   |....:|.|:
Mouse    57 QYSRIIEGQEAELGEFPWQVSIQESDHHFCGGSILSEWWILTVAHCF--YAQELSPTDLRVRVGT 119

  Fly    90 SDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTA--- 151
            :|.|.....:.|..||.|..| ....|:||||::.|.:||.:::...||.|.     :.|..   
Mouse   120 NDLTTSPVELEVTTIIRHKGF-KRLNMDNDIALLLLAKPLTFNELTVPICLP-----LWPAPPSW 178

  Fly   152 -QLFVSGWG---STSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSC 212
             :.:|:|||   ||....|..:  |....:.:.:..:|.:.:   .::|..|.||.......|:|
Mouse   179 HECWVAGWGVTNSTDKESMSTD--LMKVPMRIIEWEECLQMF---PSLTTNMLCASYGNESYDAC 238

  Fly   213 QGDSGGPLVTSIDGRLKLY--GIVSWGFGCANAMFPGIYTKVSAYDDW---IAQT 262
            |||||||||.:.|...:.|  ||:|||..|....||||||.::.|..|   ||||
Mouse   239 QGDSGGPLVCTTDPGSRWYQVGIISWGKSCGKKGFPGIYTVLAKYTLWIEKIAQT 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 85/242 (35%)
Tryp_SPc 32..262 CDD:238113 86/244 (35%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 84/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.