DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and LOC683849

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:258 Identity:99/258 - (38%)
Similarity:142/258 - (55%) Gaps:22/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVL 75
            ||.::.......:..|:.|.:||||:.......|:||||..| .|.|||::|:...:::||||. 
  Rat     3 ALLILALVGTAVAFPVDDDDKIVGGYTCQENSVPYQVSLNSG-YHFCGGSLINDQWVVSAAHCY- 65

  Fly    76 EYSKPQYYVIRAGSSDWT--KGG-SYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRP 137
             .|:.|   :|.|..:..  :|. .::...|||.||.| |...:||||.:::|..|:..:..:..
  Rat    66 -KSRIQ---VRLGEHNINVLEGNEQFVNAAKIIKHPNF-DRKTLNNDIMLIKLSSPVKLNARVAT 125

  Fly   138 ISLATSKDIIMPT-AQLFVSGWGST-SISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMF 200
            ::|.:|   ..|. .|..:||||:| |....:|: .|:.....|..|..|..:|  .|.:|:.|.
  Rat   126 VALPSS---CAPAGTQCLISGWGNTLSFGVNEPD-LLQCLDAPLLPQADCEASY--PGKITDNMV 184

  Fly   201 CAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTI 263
            |||...||:||||||||||:|  .:|.|:  ||||||:|||....||:||||..|.|||..||
  Rat   185 CAGFLEGGKDSCQGDSGGPVV--CNGELQ--GIVSWGYGCALPDNPGVYTKVCNYVDWIEDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 91/232 (39%)
Tryp_SPc 32..262 CDD:238113 93/234 (40%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 91/232 (39%)
Tryp_SPc 24..242 CDD:238113 93/234 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.