DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and ST14

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens


Alignment Length:278 Identity:97/278 - (34%)
Similarity:139/278 - (50%) Gaps:35/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ICTSAAQNSTDVEQD--------------------GRIVGGWETHITFFPHQVSLQ-LGTRHACG 58
            :|.|......|.::|                    .|:|||.:.....:|.||||. ||..|.||
Human   578 LCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICG 642

  Fly    59 GTIISPNIILTAAHCVLE-----YSKPQYYVIRAGSSDWTK----GGSYIRVKKIIPHPEFHDPT 114
            .::||||.:::||||.::     ||.|..:....|..|.::    |....|:|:||.||.|:|.|
Human   643 ASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFT 707

  Fly   115 RMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHL 179
             .:.|||:::|::|..||..:|||.|..:..:......::|:|||.|   |......|......:
Human   708 -FDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHT---QYGGTGALILQKGEI 768

  Fly   180 RDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLVT-SIDGRLKLYGIVSWGFGCANA 243
            |..||..........:|..|.|.|..:||.|||||||||||.: ..|||:...|:||||.|||..
Human   769 RVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQR 833

  Fly   244 MFPGIYTKVSAYDDWIAQ 261
            ..||:||::..:.|||.:
Human   834 NKPGVYTRLPLFRDWIKE 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 91/238 (38%)
Tryp_SPc 32..262 CDD:238113 92/241 (38%)
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>171 CDD:307516
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060 4/23 (17%)
Tryp_SPc 615..852 CDD:238113 92/241 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3952
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.