DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and PRSS22

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:276 Identity:86/276 - (31%)
Similarity:145/276 - (52%) Gaps:27/276 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALWLICTSAAQNSTDV---------EQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNI 66
            :|.|:.::|..|:..:         :|..|:|||.::..:.:|..||:|....|.|.|::::...
Human    20 SLLLLASTAILNAARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW 84

  Fly    67 ILTAAHCVLE-YSKPQYYVIRAGSSDWTKGGSYIRVKK-----IIPHPEFHDPTRMNNDIAIVQL 125
            ::|||||..: .:||..:.:..|:  |..|....|.:|     :.|||.:........|||:|:|
Human    85 VITAAHCFKDNLNKPYLFSVLLGA--WQLGNPGSRSQKVGVAWVEPHPVYSWKEGACADIALVRL 147

  Fly   126 QQPLVYSQDIRPISLATSKDIIMPTAQLFVSGWGS----TSISQMQPEKRLRYTVVHLRDQNQCA 186
            ::.:.:|:.:.||.|..:...:.|....::|||||    ..:...|..::|:..::   |...|:
Human   148 ERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPII---DSEVCS 209

  Fly   187 RNYF---GAGTVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGI 248
            ..|:   |.|.:|..|.|||...|.||:|.|||||||:..:||...|.||:|||.|||....||:
Human   210 HLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGV 274

  Fly   249 YTKVSAYDDWIAQTIE 264
            |..:||:..|:.:.::
Human   275 YISLSAHRSWVEKIVQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 80/240 (33%)
Tryp_SPc 32..262 CDD:238113 80/242 (33%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 80/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.