DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG17242

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:259 Identity:83/259 - (32%)
Similarity:125/259 - (48%) Gaps:36/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYS 78
            |:..|.||.:.|.:..|         |...|.|.|:|:..:|.|||.|.|.:||||.|.||.: :
  Fly     7 LLLVSIAQIAADFKSIG---------IEQAPWQASVQINDKHHCGGVIYSEDIILTIAECVRK-A 61

  Fly    79 KPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMN------NDIAIVQLQQPLVYSQDIRP 137
            :.::..:|.||:....||:.::|:|:          |:.      :|:||:||:.||.....||.
  Fly    62 RLEFISVRVGSAQENAGGTVLKVEKM----------RLQVLGLRPSDVAILQLRSPLYLDGGIRA 116

  Fly   138 ISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTV-VHLRDQNQCARNYFGAGTVTNT-MF 200
            |.|||..  ::|.....|||||  .:|.|.|...:...| |.::||..||.|....|.:.:. ..
  Fly   117 IPLATIP--LVPGTNASVSGWG--QLSAMNPSSEVLLRVDVKIQDQLMCATNLALKGRLMSVGEI 177

  Fly   201 CAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIE 264
            ||........:|||..|||||.:    .:||||:||...|.......:|..::.:..||..|::
  Fly   178 CAAPAGEIPYACQGFVGGPLVAN----NRLYGILSWQSACDVLNKSSVYANIAMFKVWIESTVK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 74/235 (31%)
Tryp_SPc 32..262 CDD:238113 76/237 (32%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 76/229 (33%)
Tryp_SPc 24..232 CDD:214473 74/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.