DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG17239

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:240 Identity:92/240 - (38%)
Similarity:128/240 - (53%) Gaps:22/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIVGGWETHITFFPHQVS-LQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWTK 94
            |||||....|...|.|.| |:||..| ||..|.|.:|::|||||:.: .:.::..:|.|||....
  Fly    23 RIVGGDLITILSVPWQASILRLGRFH-CGAAIYSEDIVITAAHCLTD-RETEFLSVRVGSSFTFF 85

  Fly    95 GGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQ---LFVS 156
            ||..:||..::.|.|:..  ..:||||:::||..|.....:..|.||.:     |.|.   ..||
  Fly    86 GGQVVRVSSVLLHEEYDQ--SWSNDIAVMRLQSKLRLGSAVSVIPLADT-----PPASGSPATVS 143

  Fly   157 GWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLV 221
            |||:....:..|...|..: |.:.||:||.|:|  ...:|..|.||.  |.|:|:|.||||||||
  Fly   144 GWGAIGFKKNYPMSILSAS-VDIVDQDQCRRSY--GRKITKDMICAA--APGKDACSGDSGGPLV 203

  Fly   222 TSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEEL 266
            :.    .||.||||:|..||:..:||:|..|:....||...||.:
  Fly   204 SG----NKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAIERI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 88/231 (38%)
Tryp_SPc 32..262 CDD:238113 89/233 (38%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 88/231 (38%)
Tryp_SPc 24..237 CDD:238113 87/230 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443265
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.