DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG34458

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:263 Identity:95/263 - (36%)
Similarity:149/263 - (56%) Gaps:12/263 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSLDFRLAVALWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPN 65
            |:|::..:.:::.|:..:...:..||.::.||:||.......|||||||||..||.|||::||..
  Fly     1 MSSVNNLVKLSILLLAVTFVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDT 65

  Fly    66 IILTAAHCVLEYSKPQYYVIRAGSSDWTKG-GSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPL 129
            :|:|||||.:..:..|...| .|::|.:.| |....:.:.|.||.: :|...:.|:::::|..|:
  Fly    66 MIVTAAHCTMGQNPGQMKAI-VGTNDLSAGNGQTFNIAQFIIHPRY-NPQSQDFDMSLIKLSSPV 128

  Fly   130 VYSQDIRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQC-ARNYFGAG 193
            .....::.|.||.|...........:||:|:.: ..:|...||::..|.|..::.| ::|..|  
  Fly   129 PMGGAVQTIQLADSDSNYAADTMAMISGFGAIN-QNLQLPNRLKFAQVQLWSRDYCNSQNIPG-- 190

  Fly   194 TVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDW 258
             :|:.|.|||..:|...||||||||||  ::||  ||:|:|||||||.....|.:||.|.|...|
  Fly   191 -LTDRMVCAGHPSGQVSSCQGDSGGPL--TVDG--KLFGVVSWGFGCGAKGRPAMYTYVGALRSW 250

  Fly   259 IAQ 261
            |.|
  Fly   251 IKQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 87/229 (38%)
Tryp_SPc 32..262 CDD:238113 89/232 (38%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 87/229 (38%)
Tryp_SPc 32..254 CDD:238113 89/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452437
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.