DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and PRSS1

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:258 Identity:96/258 - (37%)
Similarity:141/258 - (54%) Gaps:24/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLE 76
            |.::...||..:...:.|.:||||:.......|:||||..| .|.|||::|:...:::|.||.  
Human   229 LLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSG-YHFCGGSLINEQWVVSAGHCY-- 290

  Fly    77 YSKPQYYVIRAG--SSDWTKGG-SYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPI 138
            .|:.|   :|.|  :.:..:|. .:|...|||.||:: |...:||||.:::|....|.:..:..|
Human   291 KSRIQ---VRLGEHNIEVLEGNEQFINAAKIIRHPQY-DRKTLNNDIMLIKLSSRAVINARVSTI 351

  Fly   139 SLATSKDIIMPTA---QLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMF 200
            ||.|:     |.|   :..:||||:|:.|.......|:.....:..|.:|..:|  .|.:|:.||
Human   352 SLPTA-----PPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASY--PGKITSNMF 409

  Fly   201 CAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTI 263
            |.|...||:||||||||||:|  .:|:|:  |:||||.|||....||:||||..|..||..||
Human   410 CVGFLEGGKDSCQGDSGGPVV--CNGQLQ--GVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTI 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 88/233 (38%)
Tryp_SPc 32..262 CDD:238113 90/235 (38%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 88/233 (38%)
Tryp_SPc 249..467 CDD:238113 90/235 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.