DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and zmp:0000001114

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_685356.5 Gene:zmp:0000001114 / 557248 ZFINID:ZDB-GENE-140106-74 Length:841 Species:Danio rerio


Alignment Length:278 Identity:95/278 - (34%)
Similarity:138/278 - (49%) Gaps:40/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CTSAAQNSTDVEQD-------------------GRIVGGWETHITFFPHQVSLQLGTR-HACGGT 60
            |.:......|.|.|                   .|||||....:..:|.||||...|: ||||.:
Zfish   568 CVNKVNAECDREDDCSDGSDEQGCDCGTRPYKHNRIVGGQNADVGEWPWQVSLHFKTQGHACGAS 632

  Fly    61 IISPNIILTAAHCVLE----YSKPQYYVIRAGSSDWTKGGSYIR---VKKIIPHPEFHDPTRMNN 118
            |||...:|.||||.::    |.....::..:|..|.......::   :|.||.||.::|.|. :.
Zfish   633 IISNKWLLCAAHCFIQPDPSYKMTSSWITYSGLRDQNTHDKSVQMRDLKTIITHPNYNDLTN-DY 696

  Fly   119 DIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFVSGWGST----SISQMQPEKRLRYTVVHL 179
            ||::::|.|||.:|..:.||.|..:..:....:..||:|||:.    |.:|:     |:...|.:
Zfish   697 DISLLELSQPLNFSNTVHPICLPATSHVFTAGSSCFVTGWGTLREGGSAAQI-----LQKAEVKV 756

  Fly   180 RDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLV-TSIDGRLKLYGIVSWGFGCANA 243
            .:...|  |....|.||:.|.|:|..:||.|:|||||||||| .|..|:....||||||.|||..
Zfish   757 INDTVC--NMVTEGQVTSRMMCSGYLSGGVDACQGDSGGPLVCLSEGGKWFQAGIVSWGEGCARR 819

  Fly   244 MFPGIYTKVSAYDDWIAQ 261
            ..||:||:|:...:||.:
Zfish   820 NKPGVYTRVTKLREWIRE 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 89/240 (37%)
Tryp_SPc 32..262 CDD:238113 90/243 (37%)
zmp:0000001114XP_685356.5 SEA 78..175 CDD:279699
CUB 208..322 CDD:238001
CUB 331..437 CDD:238001
LDLa 445..477 CDD:238060
LDLa 479..513 CDD:238060
LDLa 515..549 CDD:238060
LDLa 556..591 CDD:238060 4/22 (18%)
Tryp_SPc 602..835 CDD:214473 89/240 (37%)
Tryp_SPc 603..838 CDD:238113 90/243 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3952
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.