DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Mcpt9

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_062196.2 Gene:Mcpt9 / 54272 RGDID:3068 Length:248 Species:Rattus norvegicus


Alignment Length:252 Identity:60/252 - (23%)
Similarity:115/252 - (45%) Gaps:36/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QDGRIVGGWET---------HITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYY 83
            :.|.|:.|.|:         .|.|:.....|     :.|||.:::.:|::|||||.....|   .
  Rat    17 EGGEILWGTESKPHSRPYMAFINFYDSNSDL-----NRCGGFLVAKDIVMTAAHCNGRNIK---V 73

  Fly    84 VIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIM 148
            ::.|.:....:....|.|.|..||..|:..: :.|||.:::|::....:..::.|:|..|:|.:.
  Rat    74 ILGAHNIKKRENTQVISVLKAKPHENFNSDS-LVNDIMLLKLERKAQLNGVVKTIALPRSQDWVK 137

  Fly   149 PTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQC---ARNYFGAGTVTNTMFCAGTQAGGRD 210
            |.....|:|||  :::.......|:...:.::...:|   :|||     ..:...|.|.....:.
  Rat   138 PGQVCTVAGWG--TLANCTLSNTLQEVNLEVQKGQKCQGMSRNY-----NDSIQLCVGNPNERKA 195

  Fly   211 SCQGDSGGPLV-TSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEEL 266
            :..||||||.| ..:...:..|.:.:|       ..|.::|::|::..||.:|::.|
  Rat   196 TAGGDSGGPFVCNGVAQGIVSYRLCTW-------TPPRVFTRISSFIPWIQKTMKLL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 55/240 (23%)
Tryp_SPc 32..262 CDD:238113 57/242 (24%)
Mcpt9NP_062196.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.