DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Mcpt10

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_058842.2 Gene:Mcpt10 / 54269 RGDID:3063 Length:248 Species:Rattus norvegicus


Alignment Length:259 Identity:72/259 - (27%)
Similarity:123/259 - (47%) Gaps:50/259 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QDGRIVGGWETHITFFPHQVSLQL----GTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAG 88
            :.|.|:.|.|:.....|:..||..    ..||.|||.:::.:|::|||||             .|
  Rat    17 EGGEIIWGTESKPHSRPYMASLMFYYGNSYRHYCGGFLVAKDIVMTAAHC-------------NG 68

  Fly    89 SSDWTKGGSY----------IRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATS 143
            |:.....|::          |.|.|..||..:...:|. |||.:::|::....:..::.|:|..|
  Rat    69 SNIKVTLGAHNIKKQEKTQVIAVVKAKPHENYDRHSRF-NDIMLLKLERKAQLNGAVKTIALPRS 132

  Fly   144 KDIIMPTAQLFVSGWG---STSISQMQPEKRLRYTVVHLRDQNQC---ARNYFGAGTVTNTMFCA 202
            :|.:.|.....|:|||   :.|:|....|..|     .:::..:|   :|||     ..:...|.
  Rat   133 QDWVKPGQVCTVAGWGCLANCSLSNTLQEVNL-----EVQEGQKCEDMSRNY-----NDSIQLCV 187

  Fly   203 GTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEEL 266
            |..:.|:.:.:||||||.|  .||..:  ||||:.. |...: |.::|::|::..||.:|::.|
  Rat   188 GNPSEGKATGKGDSGGPFV--CDGVAQ--GIVSYRL-CTGTL-PRVFTRISSFIPWIQKTMKLL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 67/247 (27%)
Tryp_SPc 32..262 CDD:238113 69/249 (28%)
Mcpt10NP_058842.2 Tryp_SPc 21..241 CDD:238113 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.