DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Tmprss2

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_056590.2 Gene:Tmprss2 / 50528 MGIID:1354381 Length:490 Species:Mus musculus


Alignment Length:262 Identity:103/262 - (39%)
Similarity:145/262 - (55%) Gaps:9/262 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLDFRLAVALWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNII 67
            |...|:.|:  |.|......|  |::..|||||.......:|.||||.:...|.|||:||:|..|
Mouse   229 SCSSRMVVS--LRCIECGVRS--VKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWI 289

  Fly    68 LTAAHCVLE-YSKPQYYVIRAG--SSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPL 129
            :||||||.| .|.|:|:...||  .......||..:|:|:|.||.:...|: |||||:::||.||
Mouse   290 VTAAHCVEEPLSSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTK-NNDIALMKLQTPL 353

  Fly   130 VYSQDIRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGT 194
            .::..::|:.|.....::....:.::||||:| ..:.:....|...:|.|.:.::|...|.....
Mouse   354 AFNDLVKPVCLPNPGMMLDLDQECWISGWGAT-YEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNL 417

  Fly   195 VTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWI 259
            :|..|.|||...|..|||||||||||||..:|...|.|..|||.|||.|:.||:|..|:.:.|||
Mouse   418 ITPAMICAGFLQGSVDSCQGDSGGPLVTLKNGIWWLIGDTSWGSGCAKALRPGVYGNVTVFTDWI 482

  Fly   260 AQ 261
            .|
Mouse   483 YQ 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 93/230 (40%)
Tryp_SPc 32..262 CDD:238113 95/233 (41%)
Tmprss2NP_056590.2 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:373897 5/19 (26%)
Tryp_SPc 254..485 CDD:238113 95/233 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3952
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.