DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Prss53

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:257 Identity:70/257 - (27%)
Similarity:115/257 - (44%) Gaps:40/257 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVL----- 75
            |.:....|:...|.|.: ..|       |....|:...:.||||.::|..::||||||.:     
  Rat   332 CVACGSLSSGGPQAGAL-SQW-------PWDARLKHHGKLACGGALVSEVVVLTAAHCFIGRQTL 388

  Fly    76 -EYSKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPIS 139
             |:|    ..:.||..:|       .:|::|.|..:..| ...:|:|.:.|.||:.....:||:.
  Rat   389 EEWS----VGLGAGPEEW-------GLKQLILHGAYTHP-EGGHDVAFLLLAQPVTLGPGLRPLC 441

  Fly   140 LATSKDIIMPTAQLFVSGW--GSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGT----VTNT 198
            |..: |..:|..:   .||  |.|..:.:.....:..||:   ....|:|.:..:|:    :...
  Rat   442 LPYA-DHRLPDGE---HGWVLGLTREAGINHPHTVPVTVL---GPMACSRQHAASGSTGVPILPG 499

  Fly   199 MFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIA 260
            |.|. |..|....|:|.||.|||..|.|...|.|:.|:|..|..:..|.::..:|||:||::
  Rat   500 MICT-TVVGEPPHCEGLSGAPLVHEIRGTWFLAGLHSFGDTCQGSAKPAVFAALSAYEDWVS 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 65/239 (27%)
Tryp_SPc 32..262 CDD:238113 66/241 (27%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 68/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.