DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Prss33

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001102497.1 Gene:Prss33 / 497873 RGDID:1583742 Length:277 Species:Rattus norvegicus


Alignment Length:256 Identity:89/256 - (34%)
Similarity:124/256 - (48%) Gaps:18/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKP 80
            |.:..|    .....|||||.:.....:|.|.|:|....|.|||::|:|..:|||.||......|
  Rat    22 CAACGQ----PRMSSRIVGGRDAQDGEWPWQTSIQHRGAHVCGGSLIAPQWVLTAGHCFSRRVLP 82

  Fly    81 QYYVIRAGSSDWTKGGSY---IRVKKIIPHPEF-HDPTRMNNDIAIVQLQQPLVYSQDIRPISLA 141
            ..|.:..|:.......|:   :.|.:::..|:: .|..|  .|:|::||..|:..|..|:|:.|.
  Rat    83 SEYSVLLGALSLDVTSSHELLVPVLRVLLPPDYSEDEAR--GDLALLQLSHPVSLSARIQPVCLP 145

  Fly   142 TSKDIIMPTAQLFVSGWGSTSISQMQPEKR-LRYTVVHLRDQNQCARNYFGAGTVTNT------- 198
            .......|.:..:|:||||.|.....|:.| |:...|.|.|...|.|.|.....|..:       
  Rat   146 APGSHPPPGSPCWVTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACDRLYHMGANVPKSERIVLPG 210

  Fly   199 MFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWI 259
            ..|||.:.|.:|:|||||||||.....||..|.|:||||.|||....||:||.|:.|..||
  Rat   211 NLCAGYRRGHKDACQGDSGGPLTCMESGRWVLVGVVSWGKGCALPNRPGVYTNVAKYSPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 85/239 (36%)
Tryp_SPc 32..262 CDD:238113 86/240 (36%)
Prss33NP_001102497.1 Tryp_SPc 33..271 CDD:214473 85/239 (36%)
Tryp_SPc 34..272 CDD:238113 86/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.