DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and LOC496623

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001011199.1 Gene:LOC496623 / 496623 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:260 Identity:88/260 - (33%)
Similarity:132/260 - (50%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LWLICT---SAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHC 73
            |:|:|.   :||     ...|.:|:||........|:.|||..| .|.|||::|:...:::||||
 Frog     3 LFLLCVLLGAAA-----AFDDDKIIGGATCAKNSVPYIVSLNSG-YHFCGGSLINNQWVVSAAHC 61

  Fly    74 VLEYSKPQYYVIRAGS-----SDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQ 133
            .....:     :|.|.     |:.|:  .:|...|:|.|..::..| ::|||.:::|......:.
 Frog    62 YKASIQ-----VRLGEHNIALSEGTE--QFISSSKVIRHSGYNSWT-LDNDIMLIKLSSAASLNA 118

  Fly   134 DIRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNT 198
            .:..::|.:.  .....|...:||||:|..|.......|:.....:....||...|  .|.:||.
 Frog   119 AVNAVALPSG--CAAAGASCLISGWGNTLSSGSNYPDLLQCLYAPILTDAQCNNAY--PGEITNN 179

  Fly   199 MFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTI 263
            |.|.|...||:||||||||||:|  .:|.|:  |:||||:|||...:||:||||..|:.||..||
 Frog   180 MICLGFLEGGKDSCQGDSGGPVV--CNGELQ--GVVSWGYGCAQRNYPGVYTKVCNYNSWIQSTI 240

  Fly   264  263
             Frog   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 78/232 (34%)
Tryp_SPc 32..262 CDD:238113 80/234 (34%)
LOC496623NP_001011199.1 Tryp_SPc 21..239 CDD:238113 80/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.