DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and intr

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:208 Identity:50/208 - (24%)
Similarity:83/208 - (39%) Gaps:50/208 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CGGTIISPNIILTAAHC---VLEYSKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNN 118
            |.|.:||..::||:|.|   .|....|:.|.::|..|      ....|..:|        |....
  Fly   113 CSGALISTRLVLTSALCFPRTLRQPPPRSYKLQASRS------RIYSVANLI--------TGAIE 163

  Fly   119 DIAIVQLQQPLVYSQD--IRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRD 181
            |:|::.|..||   :|  :.||.|..|     |..:       :.:::....::.||:....|..
  Fly   164 DMALLLLHAPL---EDPFVHPIDLCES-----PLRR-------NDNVTMYMSQQHLRFLRTKLIP 213

  Fly   182 QNQCARNY------FGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGC 240
            .:.|.|:|      |    :|.||.|| ..:.....||...|..|:    .:.:|.|:..:|..|
  Fly   214 NSNCKRSYAQDENAF----ITQTMLCA-LNSNRLVDCQTAKGDVLL----HQDRLCGVDIYGQHC 269

  Fly   241 ANAMFPG-IYTKV 252
            ::....| :|..|
  Fly   270 SDGGVNGELYADV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 50/208 (24%)
Tryp_SPc 32..262 CDD:238113 50/208 (24%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 50/208 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.