DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG34129

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:262 Identity:68/262 - (25%)
Similarity:109/262 - (41%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLE 76
            :|    ...|::|     |...|||...|        |......|||....:|.:::|:|:|:..
  Fly    40 VW----GGVQSNT-----GPNFGGWLLRI--------LNGDGNFACGAAYYAPLLVITSANCIYP 87

  Fly    77 YSKPQYYVIRAGSSDWTKGGSYIRVKK-------IIPHPEFHDPTRMNNDIAIVQLQQPLVYSQD 134
            |...     ..|::  .:|.::....:       .|..||.....::..|:|:|:|:.| |..:.
  Fly    88 YRNS-----LEGAT--VEGTAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDP-VRGRL 144

  Fly   135 IRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTM 199
            ...|.|.:.|  :.|..|:.|.|||..:.....|....|...|.:....:| |..|.:..:.:|.
  Fly   145 TEFIRLCSVK--VQPKMQMVVFGWGFDNTEVEIPSSDPRNVTVTIISIKEC-RQKFKSPKIASTS 206

  Fly   200 FCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIE 264
            .|| .|......|..|.|.||   |.|| :|.|:||:|..|.:...||:||.:.....:|.:|.|
  Fly   207 ICA-RQPKNPKQCLYDGGSPL---IYGR-ELCGVVSFGSHCIDTSRPGMYTNIRRVKRFITETEE 266

  Fly   265 EL 266
            .:
  Fly   267 SI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 61/234 (26%)
Tryp_SPc 32..262 CDD:238113 62/236 (26%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 65/253 (26%)
Tryp_SPc 55..261 CDD:304450 59/229 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.