DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG15498

DIOPT Version :10

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster


Alignment Length:44 Identity:13/44 - (29%)
Similarity:21/44 - (47%) Gaps:3/44 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 VSGWGSTSISQ---MQPEKRLRYTVVHLRDQNQCARNYFGAGTV 195
            |..|..|::|:   |...|:.|.:...|.|:.:...:.|..|||
  Fly     8 VGNWLETALSEEMRMSEMKKRRESGNLLLDRTRAVYDRFYQGTV 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 13/44 (30%)
CG15498NP_650974.1 None

Return to query results.
Submit another query.