DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG12951

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:277 Identity:86/277 - (31%)
Similarity:136/277 - (49%) Gaps:39/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSLDFRLAVALWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQ-LGTRHACGGTIISP 64
            :::.|..|::.:.|..|:..|.:..:   .|:|.|.::.:..:|..|||: ....|:|||:|||.
  Fly     2 LSNQDLSLSLIVILAVTTVGQAAPSI---SRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISK 63

  Fly    65 NIILTAAHCVLEYSKP------QYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMN-NDIAI 122
            :.::|||||.  ..:|      |:.|....:    .|.:.:.:||||.|.:| ||||.| |||::
  Fly    64 HFVMTAAHCT--NGRPADTLSIQFGVTNISA----MGPNVVGIKKIIQHEDF-DPTRQNANDISL 121

  Fly   123 VQLQQPLVY-SQDIRPISLATSKDIIMPTAQLFVS----GWGST----SISQMQPEKRLRYTVVH 178
            :.:::|..: ...:.|:.| .:....:|.:...|.    |||..    |:.....|..|:     
  Fly   122 LMVEEPFEFDGVSVAPVEL-PALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLK----- 180

  Fly   179 LRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGF-GCAN 242
            :....:|...:.|. |......|.|...||:..|.|||||||:  .:|  :..|||||.. .|..
  Fly   181 IYSDEECTSRHNGQ-TDPKYHICGGVDEGGKGQCSGDSGGPLI--YNG--QQVGIVSWSIKPCTV 240

  Fly   243 AMFPGIYTKVSAYDDWI 259
            |.:||:|.|||.|.|||
  Fly   241 APYPGVYCKVSQYVDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 79/245 (32%)
Tryp_SPc 32..262 CDD:238113 80/246 (33%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 79/245 (32%)
Tryp_SPc 30..260 CDD:238113 80/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.