DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG11037

DIOPT Version :10

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:30 Identity:9/30 - (30%)
Similarity:13/30 - (43%) Gaps:3/30 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RATGAPVNNFQYCYSTAGTQMGGPGTQMGG 146
            :.||.|....::..:|...|..||.   ||
  Fly    51 KLTGLPFQQCKHNITTVDCQPSGPA---GG 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 9/30 (30%)
CG11037NP_649272.1 Tryp_SPc 62..283 CDD:238113 6/19 (32%)

Return to query results.
Submit another query.