DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG32277

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:266 Identity:87/266 - (32%)
Similarity:129/266 - (48%) Gaps:59/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLE--YSKPQYYVIRAGS- 89
            :.|:|.||..|.:......|:|:.|.:..|||.|||||.:|||||| ||  |.:.:...:.|.. 
  Fly    23 RQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHC-LEGRYQQVRDLTVHAQQQ 86

  Fly    90 ------------SDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLAT 142
                        |.|..|.|          |.:.....:::|:|:::|.         ||..:|.
  Fly    87 CLGDDMPPEHVRSAWYVGLS----------PNYCAQRGLDSDLAVIRLS---------RPFDIAG 132

  Fly   143 SKDIIM-------PTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAG--TVTNT 198
            :..::.       |.:.|.|.|||:.:.......:.|:...|.|....:|.:: .|:|  .|||.
  Fly   133 NASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVKLISHRECIKS-VGSGWQKVTNN 196

  Fly   199 MFCA-GTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSA----YDDW 258
            |||| |..|  ||:||||||||.:.:  ||  ..||||||:||.:. :||:||::|:    |  |
  Fly   197 MFCALGKNA--RDACQGDSGGPAIYA--GR--SVGIVSWGYGCGSG-YPGVYTRLSSPSITY--W 252

  Fly   259 IAQTIE 264
            :...||
  Fly   253 LKDFIE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 83/256 (32%)
Tryp_SPc 32..262 CDD:238113 84/258 (33%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 81/247 (33%)
Tryp_SPc 27..246 CDD:238113 81/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.