DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG32271

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:262 Identity:88/262 - (33%)
Similarity:134/262 - (51%) Gaps:29/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LWLI------CTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTA 70
            |||:      |.:|:.     |.:.|||||....|...|:.|:|::|....|||::::|..::||
  Fly     4 LWLVLHLIPLCWAASN-----EANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTA 63

  Fly    71 AHCVLEYSKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDI 135
            ||||......:..|: ||.:..|:.|....|.|:.. |:.::...:.:|:|:::|:.| :....:
  Fly    64 AHCVKGIGASRILVV-AGVTRLTETGVRSGVDKVYT-PKAYNTRTLTSDVAVLKLKAP-ISGPKV 125

  Fly   136 RPISLATSK----DIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVT 196
            ..|.|..:.    |:|.      |||||..:........::|...|.|..:..|...|...||:|
  Fly   126 STIELCNTSFKAGDLIK------VSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTIT 184

  Fly   197 NTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQ 261
            ||||||.. .|.:|:|:||||||.|  ..|  :|.||||||.|||....||:||.|.....:|.:
  Fly   185 NTMFCASV-PGVKDACEGDSGGPAV--YQG--QLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDK 244

  Fly   262 TI 263
            .:
  Fly   245 AL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 81/231 (35%)
Tryp_SPc 32..262 CDD:238113 81/233 (35%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 81/231 (35%)
Tryp_SPc 25..244 CDD:238113 81/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.