DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG3650

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:239 Identity:83/239 - (34%)
Similarity:127/239 - (53%) Gaps:18/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIVGGWETHIT----FFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSD 91
            |||||..|.::    |.   |:|:......|||::::.:.::|||||:..|...: ..::.|.|.
  Fly    25 RIVGGTTTTLSAVGGFV---VNLRYDGTFYCGGSLVTSSHVVTAAHCLKGYQASR-ITVQGGVSK 85

  Fly    92 WTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFVS 156
            .::.|...||.:.. .|.....:.:|.|:.:::||..|..| .|..|.|...:  ..|...:.||
  Fly    86 LSQSGVVRRVARYF-IPNGFSSSSLNWDVGVIRLQSALTGS-GITTIPLCQVQ--WNPGNYMRVS 146

  Fly   157 GWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLV 221
            |||:|......|..:||...:.|..:..|.|.|.|..|:|.:.|||.|  ||:|||.|||||.::
  Fly   147 GWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLTASTFCART--GGKDSCSGDSGGGVI 209

  Fly   222 TSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEE 265
            .    :.:|.||||||.|||||.:||:||.|.....:|.::|::
  Fly   210 F----KNQLCGIVSWGLGCANAQYPGVYTSVHRVRSFILRSIKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 81/231 (35%)
Tryp_SPc 32..262 CDD:238113 81/233 (35%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 81/231 (35%)
Tryp_SPc 26..243 CDD:238113 80/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.