DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG32269

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:239 Identity:86/239 - (35%)
Similarity:128/239 - (53%) Gaps:17/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 STDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRA 87
            :|..:...|||||..|.|:..|:.|.|:.|: :.|.|::|:...:|||||||..||... :.:|.
  Fly   100 ATSSKIQSRIVGGTSTTISTTPYIVQLRRGS-NLCSGSLITEQWVLTAAHCVKGYSASD-FTVRG 162

  Fly    88 GSSDWTKGGSYIR-VKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTA 151
            |::.........| |..|...|:| ...:||.|.|:::|.|.|. ..:|..||:...:    |.|
  Fly   163 GTTTLDGSDGVTRSVSSIHVAPKF-TSKKMNMDAALLKLNQSLT-GTNIGTISMGNYR----PKA 221

  Fly   152 --QLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQG 214
              ::.::|||.|........|.|:...:.:..|.:|.::|.|..|:|..|.||  :|.|:|||.|
  Fly   222 GSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCA--RAAGKDSCSG 284

  Fly   215 DSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDW 258
            |||||:..:    ..|.||||:|:|||.|.:||:||.|.|...|
  Fly   285 DSGGPVTRN----NTLLGIVSFGYGCARAGYPGVYTAVVAIRQW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 85/231 (37%)
Tryp_SPc 32..262 CDD:238113 84/230 (37%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 84/229 (37%)
Tryp_SPc 121..324 CDD:238113 77/216 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.