DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG32270

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:262 Identity:94/262 - (35%)
Similarity:142/262 - (54%) Gaps:18/262 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAVALWLI-CTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAA 71
            |.:..|:: ...:.....::.:..|||||..:.:...||.|:::......|||::::|..:||||
  Fly     6 LPLMFWMLWIRESVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAA 70

  Fly    72 HCVLEYSKPQYYVIRAG---SSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQ 133
            || |....|..:|:|.|   .|| .:...|:|  ||: .|..:..|.:::|:|::||:||| .:.
  Fly    71 HC-LNDGNPSDFVVRGGVTYLSD-MRNSRYVR--KIL-MPSAYSRTTLDHDVALLQLKQPL-QAS 129

  Fly   134 DIRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNT 198
            ..:|||||....  .|.:.:.|||||.|..|......:|:...|.:..|.:|...|.|...:|::
  Fly   130 IAKPISLAVRSP--RPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSS 192

  Fly   199 MFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWG--FGCANAMFPGIYTKVSAYDDWIAQ 261
            ||||.. .|.:|:|.||||||:|.| :|  .|.|:||||  ..||....||:|:.||...||||.
  Fly   193 MFCASV-PGLKDACAGDSGGPVVNS-NG--ILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIAD 253

  Fly   262 TI 263
            .|
  Fly   254 NI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 88/232 (38%)
Tryp_SPc 32..262 CDD:238113 90/234 (38%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 88/232 (38%)
Tryp_SPc 31..254 CDD:238113 90/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.