DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG9897

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:256 Identity:78/256 - (30%)
Similarity:121/256 - (47%) Gaps:41/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWT 93
            |.||:.|...:|...|...|:.:.::..|||.|||.|.|||||.||..||.....| |.|:|...
  Fly    20 DQRIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAAKCVDGYSARSIQV-RLGTSSCG 83

  Fly    94 KGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMP--TAQLFVS 156
            ..||...:.|:..|.:: ...|.:|::|:::..:.|..:.:|:||..|..    :|  .::..|:
  Fly    84 TSGSIAGICKVKVHSQY-SSWRFDNNLALLKTCELLNTTDEIKPIERADK----VPDDNSRANVT 143

  Fly   157 GWGSTS-----------ISQMQPEK------RLRYTVVHLRDQNQCARN------YFGAGTVTNT 198
            |.|..|           ||....||      :|..|.|.:..|.|||.:      |...| :::.
  Fly   144 GCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQKQCAADWKVIPFYLLKG-ISDL 207

  Fly   199 MFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWI 259
            ..|  |::.|:.:|..|.|.|||  ||.  ||.||:|.. ||  ::.|.:|..:..:.:|:
  Fly   208 TIC--TKSPGKGACSTDRGSPLV--IDN--KLVGILSRA-GC--SIKPDVYANILGHTNWL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 76/252 (30%)
Tryp_SPc 32..262 CDD:238113 76/253 (30%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.