DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and thetaTry

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:272 Identity:96/272 - (35%)
Similarity:148/272 - (54%) Gaps:24/272 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RLAVALWLIC---------TSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGT-RHACGGTI 61
            ||.|.  |:|         |....|....|::||||||.:|.|...|:|||||..: .|.|||::
  Fly     3 RLVVL--LVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSL 65

  Fly    62 ISPNIILTAAHCVLEYSKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQ 126
            |:.:.::|||||::.....:.:| |.||:.:.:||..:.|:::..:.:::..| |..|:.|::|.
  Fly    66 INEDTVVTAAHCLVGRKVSKVFV-RLGSTLYNEGGIVVAVRELAYNEDYNSKT-MEYDVGILKLD 128

  Fly   127 QPLVYSQDIRPISLATSKDIIMPTAQLFVSGWGSTSISQ-MQPEKRLRYTVVHLRDQNQCARNYF 190
            :.:..:::||.|.|||.......||  .|:||||..... |...|.|:...|::.|...||.:.:
  Fly   129 EKVKETENIRYIELATETPPTGTTA--VVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEY 191

  Fly   191 GAGTVT-NTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSA 254
            ..|.:. ::|.||..:.  :|:|||||||||...    ..|.||||||:.||:.:.||:|:.|.|
  Fly   192 KYGEIIYDSMVCAYEKK--KDACQGDSGGPLAVG----NTLVGIVSWGYACASNLLPGVYSDVPA 250

  Fly   255 YDDWIAQTIEEL 266
            ...||....|.|
  Fly   251 LRKWILNASETL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 83/230 (36%)
Tryp_SPc 32..262 CDD:238113 84/232 (36%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 83/230 (36%)
Tryp_SPc 35..255 CDD:238113 82/229 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452487
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.