DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and etaTry

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:269 Identity:94/269 - (34%)
Similarity:138/269 - (51%) Gaps:21/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSLDFRLAVALWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGT------RHACGG 59
            |..:..|:...|:|:...|    ...:.|||||||.:|...:..:.|.|:..:      ...|||
  Fly     1 MNKVILRILAVLFLLGIYA----VSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGG 61

  Fly    60 TIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQ 124
            .|:....|.||||||.......:.|:....|.....|..:||.|:||| |.::.:.|:||||:|.
  Fly    62 CILDAVTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPH-ELYNSSTMDNDIALVV 125

  Fly   125 LQQPLVYS--QDIRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCAR 187
            :..||...  ..:..|.:|:.:..:  ..|..:||||.|..:.:..: :|:...|.:.|..:|..
  Fly   126 VDPPLPLDSFSTMEAIEIASEQPAV--GVQATISGWGYTKENGLSSD-QLQQVKVPIVDSEKCQE 187

  Fly   188 NYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKV 252
            .|:.. .::..|.|||...||:|:||||||||||.:    .||.||||||.|||...:||:|..|
  Fly   188 AYYWR-PISEGMLCAGLSEGGKDACQGDSGGPLVVA----NKLAGIVSWGEGCARPNYPGVYANV 247

  Fly   253 SAYDDWIAQ 261
            :.|.||||:
  Fly   248 AYYKDWIAK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 84/235 (36%)
Tryp_SPc 32..262 CDD:238113 86/238 (36%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 84/235 (36%)
Tryp_SPc 28..257 CDD:238113 86/238 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.