DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and zetaTry

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster


Alignment Length:245 Identity:95/245 - (38%)
Similarity:133/245 - (54%) Gaps:21/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DGRIVGGWETHITFFPHQVSLQ---LGT-----RHACGGTIISPNIILTAAHCVLEYSKPQYYVI 85
            |||||||:.|.|...|:|:||:   :.|     ||.|||:|.:...|:||||||:.....||.|:
  Fly    36 DGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCGGSIFNETTIVTAAHCVIGTVASQYKVV 100

  Fly    86 RAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQ-DIRPISLATSKDIIMP 149
            ...:......|....||:|:.|..::.....||||||:.:..||..:. .|:.|.||..:.|...
  Fly   101 AGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAILFVDPPLPLNNFTIKAIKLALEQPIEGT 165

  Fly   150 TAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNY--FGAGT--VTNTMFCAGTQ-AGGR 209
            .::  |||||:||.......:.|...|..:.:: .|.::|  ||..|  :|:.|.|||.: .||.
  Fly   166 VSK--VSGWGTTSPGGYSSNQLLAVDVPIVSNE-LCDQDYEDFGDETYRITSAMLCAGKRGVGGA 227

  Fly   210 DSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWI 259
            |:|||||||||..    |.:|||:||||..||...:||:|..|:....||
  Fly   228 DACQGDSGGPLAV----RDELYGVVSWGNSCALPNYPGVYANVAYLRPWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 91/241 (38%)
Tryp_SPc 32..262 CDD:238113 92/242 (38%)
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 91/241 (38%)
Tryp_SPc 39..276 CDD:238113 92/242 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443256
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.