DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Send2

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:257 Identity:90/257 - (35%)
Similarity:133/257 - (51%) Gaps:31/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLE 76
            |.|:..::......:..:.||:||....|...|.|||:|...:|.|||:|.|.:||:||||||  
  Fly     7 LLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCV-- 69

  Fly    77 YSKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLA 141
              :.|.|.:||||:.....||.:.|..|..|      ..:.||||||:|.:||.::..::||.||
  Fly    70 --QGQGYQVRAGSALKNSNGSVVDVAAIRTH------EGLGNDIAIVRLSKPLEFTNQVQPIPLA 126

  Fly   142 TSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYT-VVHLRDQNQCARNYFGAGTVTNTMFCAGTQ 205
            .:..  .|.:..|||||||:|.          |: .:.|:..|...:..:..|....:..|||  
  Fly   127 KTNP--PPGSIAFVSGWGSSSY----------YSHPIDLQGVNLYIQWPYYCGLTEPSRICAG-- 177

  Fly   206 AGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEELV 267
            :.||.:|:||||||||..    .:|.|:||.  |..:..:..|||.|..:.:||...|:|::
  Fly   178 SFGRAACKGDSGGPLVFD----QQLVGVVSG--GTKDCTYSSIYTSVPYFREWILNAIDEIM 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 84/228 (37%)
Tryp_SPc 32..262 CDD:238113 85/230 (37%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 84/228 (37%)
Tryp_SPc 27..225 CDD:238113 83/227 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.