DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Try29F

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:232 Identity:94/232 - (40%)
Similarity:136/232 - (58%) Gaps:8/232 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWT 93
            |||||||...:|...|:||||| .:.|.|||::|:...:||||||. |.|......:|.|||..:
  Fly    39 DGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAHCT-EGSAILLSKVRIGSSRTS 101

  Fly    94 KGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFVSGW 158
            .||..:.:|::..||:| |...::.|.::::|::....:.....:.|......|.....:.||||
  Fly   102 VGGQLVGIKRVHRHPKF-DAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIADGTPVLVSGW 165

  Fly   159 GSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLVTS 223
            |:|..:| :....||...|....|.||...|...|::|:.|.|||...||:|:|||||||||  :
  Fly   166 GNTQSAQ-ETSAVLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEGGKDACQGDSGGPL--A 227

  Fly   224 IDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIA 260
            .||  .|:|:||||:|||...:||:|::|||..|||:
  Fly   228 ADG--VLWGVVSWGYGCARPNYPGVYSRVSAVRDWIS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 90/227 (40%)
Tryp_SPc 32..262 CDD:238113 91/229 (40%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 90/227 (40%)
Tryp_SPc 42..264 CDD:238113 91/229 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443348
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.