DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and PRSS53

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:298 Identity:68/298 - (22%)
Similarity:109/298 - (36%) Gaps:77/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QDGRIV-GGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQ---YYVI--- 85
            |:|..| |.|       |.|.|::....|.|.|::::...:||||||..:.:..:   :.|:   
Human    39 QEGNTVPGEW-------PWQASVRRQGAHICSGSLVADTWVLTAAHCFEKAAATELNSWSVVLGS 96

  Fly    86 --RAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIM 148
              |.|.|   .|...:.| ..:..|..::.....:|:|::||..|..::    |:.|........
Human    97 LQREGLS---PGAEEVGV-AALQLPRAYNHYSQGSDLALLQLAHPTTHT----PLCLPQPAHRFP 153

  Fly   149 PTAQLFVSGWG-STSISQMQPE------------------------------------------- 169
            ..|..:.:||. .||..:..|.                                           
Human   154 FGASCWATGWDQDTSDGKCWPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAP 218

  Fly   170 ---KRLRYTVVHLRDQNQCARNYFGAGTVTNT----MFCAGTQAGGRDSCQGDSGGP-LVTSIDG 226
               :.||..::. |....|..|......::|.    |.|.|.|.|.:..|||||||| |....||
Human   219 GTLRNLRLRLIS-RPTCNCIYNQLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDG 282

  Fly   227 RLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIE 264
            .....||:|:...||....|.:.|..:|:..|:...::
Human   283 HWVQAGIISFASSCAQEDAPVLLTNTAAHSSWLQARVQ 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 65/288 (23%)
Tryp_SPc 32..262 CDD:238113 66/290 (23%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 66/289 (23%)
Tryp_SPc 43..314 CDD:214473 65/286 (23%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149448
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.