DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and prss60.3

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:263 Identity:95/263 - (36%)
Similarity:138/263 - (52%) Gaps:19/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LICTSAAQNSTDV----EQDGRIVGGWETHITFFPHQVSL---QLGTRHACGGTIISPNIILTAA 71
            |||...:.:..:|    ..:.|||||.......:|.||||   :.| .|.|||::||...:||||
Zfish    14 LICVKGSLSQLNVCGQAPLNTRIVGGVNASPGSWPWQVSLHSPKYG-GHFCGGSLISSEWVLTAA 77

  Fly    72 HCVLEYSKPQYYVIRAGSSDWTKGGSYI-----RVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVY 131
            ||:...|:.. .|:..|..  |:.|..|     .|.|...|..::..|. :||||:::|...:.:
Zfish    78 HCLSGVSETT-LVVYLGRR--TQQGINIYETSRNVAKSFVHSSYNSNTN-DNDIALLRLSSAVTF 138

  Fly   132 SQDIRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKR-LRYTVVHLRDQNQCARNYFGAGTV 195
            :..|||:.||....:.......:::|||........|... |:.|::.:...::| ....|:|||
Zfish   139 TNYIRPVCLAAQNSVYSAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRC-NALLGSGTV 202

  Fly   196 TNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIA 260
            ||.|.|||...||:|:||||||||:||.:.......||.|||:|||:...||:||:||.|..||:
Zfish   203 TNNMICAGLTQGGKDTCQGDSGGPMVTRLCTVWVQAGITSWGYGCADPNSPGVYTRVSQYQSWIS 267

  Fly   261 QTI 263
            ..|
Zfish   268 SKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 88/236 (37%)
Tryp_SPc 32..262 CDD:238113 89/238 (37%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 89/238 (37%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.