DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Ser12

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:256 Identity:102/256 - (39%)
Similarity:137/256 - (53%) Gaps:17/256 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEY 77
            ||:..::....:......|||||....|:..|.|.:|....::.||..|.|..||:|||||| |.
  Fly     5 WLVLVASVTLISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCV-ER 68

  Fly    78 SKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLAT 142
            .....|.:|.||.....||.:.||..|..|.::...|.:.||||:::|...|:::.::|||.||.
  Fly    69 PFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLAD 133

  Fly   143 SKDIIMPTA--QLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQ 205
            |    .|.|  :..|||||...|..:||...|: |.|.:.|.|.|.|:|   ..:|.||.||...
  Fly   134 S----APAAGTEASVSGWGEIGILWLQPTSLLK-TSVKILDPNVCKRSY---QYITKTMICAAAL 190

  Fly   206 AGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEEL 266
            .  :|||.||||||||:.  |  :|.||||:|.||||..|||:|..|:....||...||:|
  Fly   191 L--KDSCHGDSGGPLVSG--G--QLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIEQL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 95/229 (41%)
Tryp_SPc 32..262 CDD:238113 96/231 (42%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 95/229 (41%)
Tryp_SPc 24..238 CDD:238113 94/228 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443263
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.