DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and sphe

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:250 Identity:72/250 - (28%)
Similarity:116/250 - (46%) Gaps:41/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSK---PQYYVIRAGSSD 91
            |||:||.:...|......||::...|.|||:|:|...|||.||||....|   ......|.||::
  Fly    24 GRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTN 88

  Fly    92 WTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPT--AQLF 154
            ...||..:.|:.:..||::::   :||::|::.|...|.|:..|..|.|..|.: .:|.  :::.
  Fly    89 QYAGGKIVNVESVAVHPDYYN---LNNNLAVITLSSELTYTDRITAIPLVASGE-ALPAEGSEVI 149

  Fly   155 VSGWGSTS----------IS-QMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGG 208
            |:|||.||          || ::.||...........:|:.|..:....||              
  Fly   150 VAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELKEGT-------------- 200

  Fly   209 RDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTI 263
               |.||.||   .:|.|. .|.|:.::..|...:.:|.::.::|:|.|||.:.|
  Fly   201 ---CHGDGGG---GAIYGN-TLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 68/243 (28%)
Tryp_SPc 32..262 CDD:238113 69/245 (28%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 65/229 (28%)
Tryp_SPc 42..244 CDD:214473 63/226 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.