DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG32834

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:273 Identity:87/273 - (31%)
Similarity:138/273 - (50%) Gaps:34/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVALWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHC 73
            :|.|:|:.........|::...||:||::..|...|:|..:.:.....|.|.||:.:.|:|||.|
  Fly     4 SVFLFLLAALLRPVRGDLDAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAASC 68

  Fly    74 VLEYSKPQYYVIRAGSS--DWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIR 136
            |..|...:   :|.|:|  |:...|..:.|.:||.||:: :..|.:|::|:::|..||..|:.|:
  Fly    69 VQSYGSIE---VRVGTSSRDYDGTGFLLEVCEIINHPQY-NCWRFDNNLALLKLCDPLKTSEAIQ 129

  Fly   137 PISLATSKDIIMPTAQLFVSGWGSTS---------ISQMQPEKRLRYTVVHLRDQNQCARN---Y 189
            |||:|  :|.....:...||||||||         ...:....::.:..|:.|:  |||.:   :
  Fly   130 PISIA--EDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNRE--QCAADRGVW 190

  Fly   190 FGA--GTVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKV 252
            ||.  ..::....|....|||   |..|:|.|||  |||  :|.||:|.| ||...  |.:|..|
  Fly   191 FGLWDNGISYLTLCTHNGAGG---CSYDTGAPLV--IDG--QLVGILSEG-GCTTK--PDVYANV 245

  Fly   253 SAYDDWIAQTIEE 265
            ..:..|||:..|:
  Fly   246 PWFTGWIAENTED 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 79/243 (33%)
Tryp_SPc 32..262 CDD:238113 81/245 (33%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 79/243 (33%)
Tryp_SPc 27..255 CDD:238113 81/245 (33%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.