DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG32376

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:236 Identity:88/236 - (37%)
Similarity:125/236 - (52%) Gaps:11/236 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWTKG 95
            |||.|.....|..|.|.||.......||..||:...||||.||.  :..|:.|.:|.||....:|
  Fly    65 RIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCF--FGPPEKYTVRVGSDQQRRG 127

  Fly    96 GSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFVSGWGS 160
            |....||||:....::|.| |.:|:|:::|:.|:.:.:.:||:.|.::|....| .:..|||||.
  Fly   128 GQLRHVKKIVALAAYNDYT-MRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFP-KKFVVSGWGI 190

  Fly   161 TSISQMQPEKRLRYTVVHLRDQNQCARNYFGAG-TVTNTMFCAGTQAGGRDSCQGDSGGPLVTSI 224
            ||.:....::.||...:....:::|.:.|..|| .:...|.||...  .:|||.|||||||.:  
  Fly   191 TSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASRT--NKDSCSGDSGGPLTS-- 251

  Fly   225 DGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEE 265
              |..||||||||.||||..:||:|.....|..||.:.|.:
  Fly   252 --RGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWIKKVIHK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 85/228 (37%)
Tryp_SPc 32..262 CDD:238113 86/230 (37%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 85/228 (37%)
Tryp_SPc 66..287 CDD:238113 86/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.