DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG6041

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:281 Identity:89/281 - (31%)
Similarity:138/281 - (49%) Gaps:44/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAVALWLICTSAAQ---NSTDVEQDGRIVGGWETHITFFPHQVSLQL--------GTRHACGGTI 61
            ||:||:|...::.:   :.|..:.:.:||||::..|....:|||::|        |:.|.|||.:
  Fly     8 LAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVV 72

  Fly    62 ISPNIILTAAHCVLEYSKPQYYVIRAGSSDWTKGGSYIR----------VKKIIPHPEFHDPTRM 116
            ||..::.|||||.....|.:|..  ||......|.:|:.          ::::|.| |.::|..:
  Fly    73 ISQRLVATAAHCCYITDKKKYRT--AGEFVLVMGSTYLTSSTDRTLMYYLQQLITH-ENYNPDAL 134

  Fly   117 NNDIAI------VQLQQPLVYSQDIRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYT 175
            .||||:      :....|.|       .:||.:..::.......:||||....:.......|:..
  Fly   135 TNDIALMFINGYIPWNWPTV-------TALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAA 192

  Fly   176 VVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGC 240
            .|.:.....|..:|   .::..:..|||..:||.|:||||||||:  |.:|.|.  ||||:|.||
  Fly   193 TVPIVSYTTCRISY---NSIPVSQVCAGYLSGGVDACQGDSGGPM--SCNGMLA--GIVSYGAGC 250

  Fly   241 ANAMFPGIYTKVSAYDDWIAQ 261
            |...:||:||.||.|.|||.|
  Fly   251 AAPGYPGVYTNVSYYYDWIVQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 80/251 (32%)
Tryp_SPc 32..262 CDD:238113 83/254 (33%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 80/251 (32%)
Tryp_SPc 35..272 CDD:238113 83/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.