DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG3795

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:288 Identity:79/288 - (27%)
Similarity:122/288 - (42%) Gaps:53/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LWLICTSAAQNSTDVEQDGR------------------IVGGWETHIT-FFPHQVSLQL------ 51
            ::::..|.:.||....|.|:                  :.||:..... ...:.|||::      
  Fly     8 VYILLISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTVSLRMGKPKKF 72

  Fly    52 -GTRHACGGTIISPNIILTAAHCVLEYS---KPQYYVIRAGS------SDWTKGGSYIRVKKIIP 106
             |..|.|.|||.|...|||||||:....   |.:..::.||:      |..|:   .|..::::|
  Fly    73 FGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQ---IIEAEELLP 134

  Fly   107 HPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKR 171
            ||::........||.::.|:..|.....:..|.|...  :.:..|...:.|||:.......|::.
  Fly   135 HPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNK--VPVAGAPCSIVGWGTVIQFGPLPDEA 197

  Fly   172 LRYTVVHLRDQNQCAR--NYFGAGTVTNTMFCAGTQAGGR-DSCQGDSGGPLVTSIDGRLKLYGI 233
            :...:..|.| ..|.:  .:..||     |.||..:.... |||||||||||:  .|..:.  ||
  Fly   198 INGDMQILPD-TFCEKLLGWSNAG-----MLCANDKHDSDVDSCQGDSGGPLI--CDNMVT--GI 252

  Fly   234 VSWGFGCANAMFPGIYTKVSAYDDWIAQ 261
            ||:|.||......||||.|..:.|||.:
  Fly   253 VSFGMGCGEPDSAGIYTDVYHFRDWITE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 72/265 (27%)
Tryp_SPc 32..262 CDD:238113 74/250 (30%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 72/236 (31%)
Tryp_SPc 60..278 CDD:214473 70/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.