DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and CG14780

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:271 Identity:89/271 - (32%)
Similarity:130/271 - (47%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VALWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQL-------GTRHACGGTIISPNII 67
            :..|.:...||.:..: .|..||:.|.........|.||::|       |:.|.|||.:|:|..:
  Fly    12 ILFWFLLACAAADLQE-NQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKV 75

  Fly    68 LTAAHCVLEYSKPQY-----YVIRAGSSD--WTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQL 125
            ||||||:....:.::     :|:..|:.:  ..:.|:.:.....:.:.....|..|.:|:.|:.|
  Fly    76 LTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFL 140

  Fly   126 QQPLVYSQ------DIRPISLATSKDIIMPTAQLF-VSGWGSTSISQMQPEKRLRYTVVHLRDQN 183
            :..|..|.      .:.||.||..   |.|..:|. |:|||.|..|.:. ...|...|..:|  :
  Fly   141 RTGLPMSPGGGVHLTVAPIQLAGQ---ITPPGKLCQVAGWGRTEQSSLS-NILLTANVSTIR--H 199

  Fly   184 QCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGI 248
            |..|..:.:|.:.. |.|||...||.||||||||||||.  :||  |.|:||||:|||....||:
  Fly   200 QTCRMIYRSGLLPG-MMCAGRLQGGTDSCQGDSGGPLVH--EGR--LVGVVSWGYGCAEPGLPGV 259

  Fly   249 YTKVSAYDDWI 259
            |..|..|..||
  Fly   260 YVDVEYYRQWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 83/248 (33%)
Tryp_SPc 32..262 CDD:238113 84/249 (34%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 83/248 (33%)
Tryp_SPc 33..271 CDD:238113 84/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.