DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:238 Identity:85/238 - (35%)
Similarity:123/238 - (51%) Gaps:6/238 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWTKG 95
            |||||.......:|.|.||:|...|.|||:::||..:||||||.........|.:..|....|..
  Rat    29 RIVGGHAAQAGAWPWQASLRLQKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYEVHLGELTITLS 93

  Fly    96 GSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFVSGWGS 160
            ..:..||:||.:.....|...:.|||:|||..|:..|..::|:.|..:.....|..|.:|:|||.
  Rat    94 PHFSTVKQIIMYSSAPGPPGSSGDIALVQLATPVALSSQVQPVCLPEASADFHPGMQCWVTGWGY 158

  Fly   161 TSISQ-MQPEKRLRYTVVHLRDQNQCARNYFGA--GTVTNTMFCAGTQAGGRDSCQGDSGGPLVT 222
            |...: ::|...|:...|.:.|...|::.|..:  ..:.:.|.||.   |..|:||.|||||||.
  Rat   159 TQEGEPLKPPYNLQEAKVSVVDVETCSQAYSSSNGSLIQSDMLCAW---GPGDACQDDSGGPLVC 220

  Fly   223 SIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEE 265
            .:.|..:..|:||||.||.....||:|.:|:||.:||.:.|.|
  Rat   221 RVAGIWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHRHILE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 81/230 (35%)
Tryp_SPc 32..262 CDD:238113 82/232 (35%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 81/230 (35%)
Tryp_SPc 30..260 CDD:238113 82/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.