DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:252 Identity:90/252 - (35%)
Similarity:128/252 - (50%) Gaps:15/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VEQDGRIVGGWETHITFFPHQVSLQLG---TRHACGGTIISPNIILTAAHCV-LEYSKPQYYVIR 86
            |:|...||||.|...:.:|.||||:..   ..|.|||::|.|..:||||||| |....|:.:.::
  Rat    24 VKQRVGIVGGREASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWVLTAAHCVGLHIKSPELFRVQ 88

  Fly    87 AGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTA 151
            ............:.|.:.:.||.:: ......|||:::|:.|:..|..|.|.||..:.:......
  Rat    89 LREQYLYYADQLLTVNRTVVHPHYY-TVEDGADIALLELENPVNVSTHIHPTSLPPASETFPSGT 152

  Fly   152 QLFVSGWGS-TSISQMQPEKRLRYTVVHLRDQNQCARNYF-GAGT------VTNTMFCAGTQAGG 208
            ..:|:|||. .|...:.|...|:...|.:.:.:.|.|.|. |..|      |.:.|.|||.... 
  Rat   153 SCWVTGWGDIDSDEPLLPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDVPIVQDGMLCAGNTRS- 216

  Fly   209 RDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEE 265
             ||||||||||||..:.|.....|:||||.|||.|..|||||:|:.|.|||.:.:.:
  Rat   217 -DSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAEANRPGIYTRVTYYLDWIHRYVPQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 86/239 (36%)
Tryp_SPc 32..262 CDD:238113 88/241 (37%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 88/240 (37%)
Tryp_SPc 30..266 CDD:214473 86/238 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.