DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Prss30

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:247 Identity:88/247 - (35%)
Similarity:126/247 - (51%) Gaps:14/247 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRIVGGWETHITFFPHQVSLQLGTR-HACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGS---S 90
            |:||||.:.....:|.||||:.... |.|||::|....:||||||........:|.::.|.   |
  Rat    29 GKIVGGQDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGLTLS 93

  Fly    91 DWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFV 155
            ......:.:.|:.|..:|.:......:.|||:::|..||..|| ..|:.|..::..:.|....:|
  Rat    94 LTEPHSTLVAVRNIFVYPTYLWEDASSGDIALLRLDTPLQPSQ-FSPVCLPQAQAPLTPGTVCWV 157

  Fly   156 SGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYF-------GAGTVTNTMFCAGTQAGGRDSCQ 213
            :|||:|  .:.:....|:...|.|.|...|.|.|.       |...:.:.|.|||...|.:||||
  Rat   158 TGWGAT--HERELASVLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSDMLCAGFVEGQKDSCQ 220

  Fly   214 GDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEE 265
            ||||||||.:|:......||.|||.|||....||:||:|..|.|||.:|:.|
  Rat   221 GDSGGPLVCAINSSWIQVGITSWGIGCARPNKPGVYTRVPDYVDWIQRTLAE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 83/238 (35%)
Tryp_SPc 32..262 CDD:238113 85/240 (35%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.