DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Gzmf

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_703196.2 Gene:Gzmf / 266704 RGDID:628603 Length:248 Species:Rattus norvegicus


Alignment Length:242 Identity:67/242 - (27%)
Similarity:117/242 - (48%) Gaps:21/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IVGGWETHITFFPHQVSLQL----GTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSD- 91
            |:||.|......|:...::.    |.|..|||.::....:||||||.....|     :..|:.: 
  Rat    21 IIGGHEVKPHSRPYMAHVKFVKVDGNRSVCGGFLVQDYFVLTAAHCTGRSMK-----VILGAHNL 80

  Fly    92 --WTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLF 154
              ..|....|.||:.||||.::....: |||.:::|:.....::.:||::|....|::.|.....
  Rat    81 HVQEKTQQIIPVKRAIPHPAYNREDHI-NDIMLLKLESKAKKTRAVRPLNLPRPNDMVKPGDVCR 144

  Fly   155 VSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGP 219
            |:|||..|:...:...||:...:.:::..:|.:.:......|.  .|||.....:.:.:||||||
  Rat   145 VAGWGQMSVDVTKRTSRLQEAKLIIQEDKECKKLFHHYSETTE--ICAGDPKKIQAAYKGDSGGP 207

  Fly   220 LVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEEL 266
            ||.    ..:.||:||:|..  ..:..|::|||..:..||::.::.|
  Rat   208 LVC----ENRAYGVVSYGKN--GTISSGVFTKVVYFLPWISRNMKLL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 64/233 (27%)
Tryp_SPc 32..262 CDD:238113 66/236 (28%)
GzmfNP_703196.2 Tryp_SPc 21..244 CDD:238113 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.