DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and PRSS33

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:273 Identity:92/273 - (33%)
Similarity:128/273 - (46%) Gaps:26/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LAVALWLICTSAAQNST------DVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNI 66
            |.|.|.|:..:|.....      ......|||||.:.....:|.|.|:|....|.|||::|:|..
Human     7 LQVLLLLVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQW 71

  Fly    67 ILTAAHCVLEYSKPQYYVIRAGSSDWTKGGS------YIRVKKIIPHPEF-HDPTRMNNDIAIVQ 124
            :||||||....:.|..|.:|.|:   .:.||      .:.|::::..|:: .|..|  .|:|::|
Human    72 VLTAAHCFPRRALPAEYRVRLGA---LRLGSTSPRTLSVPVRRVLLPPDYSEDGAR--GDLALLQ 131

  Fly   125 LQQPLVYSQDIRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKR-LRYTVVHLRDQNQCARN 188
            |::|:..|..::|:.|........|.....|:||||.......||.| |:...|.|.|...|...
Human   132 LRRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCDGL 196

  Fly   189 YFGAGTVTNT-------MFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFP 246
            |.....|...       ..|||...|.:|:|||||||||.....|...|.|:||||.|||....|
Human   197 YHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRP 261

  Fly   247 GIYTKVSAYDDWI 259
            |:||.|:.|..||
Human   262 GVYTSVATYSPWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 85/242 (35%)
Tryp_SPc 32..262 CDD:238113 86/243 (35%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 86/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3952
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.