DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:274 Identity:96/274 - (35%)
Similarity:139/274 - (50%) Gaps:18/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RLAVALW---LICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTR---HACGGTIISPN 65
            ||.:.||   |:.:..........|...||||.|...:.:|.||||:....   |.|||::|.|.
Mouse     4 RLLLLLWALSLLASLVYSAPRPANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQ 68

  Fly    66 IILTAAHCVLEYSK-PQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPL 129
            .:|||||||..:.| ||.:.::........|...:.:.:|:.||.:: ......|:|:::|:.|:
Mouse    69 WVLTAAHCVGPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYY-TAEGGADVALLELEVPV 132

  Fly   130 VYSQDIRPISLATSKDIIMPTAQLFVSGWGSTSISQ-MQPEKRLRYTVVHLRDQNQCARNYF-GA 192
            ..|..:.||||..:.:...|....:|:|||.....: :.|...|:...|.:.:.:.|.|.|. |.
Mouse   133 NVSTHLHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKYHTGL 197

  Fly   193 GT------VTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTK 251
            .|      |.:.|.|||...  |||||||||||||..:.|.....|:||||.|||....|||||:
Mouse   198 YTGDDFPIVHDGMLCAGNTR--RDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPGIYTR 260

  Fly   252 VSAYDDWIAQTIEE 265
            |:.|.|||.:.:.|
Mouse   261 VTYYLDWIHRYVPE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 87/239 (36%)
Tryp_SPc 32..262 CDD:238113 89/241 (37%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 89/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.