DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and Prss1

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_444473.1 Gene:Prss1 / 114228 MGIID:98839 Length:246 Species:Mus musculus


Alignment Length:258 Identity:101/258 - (39%)
Similarity:141/258 - (54%) Gaps:22/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVL 75
            ||..:....|..:..|:.|.:||||:.......|:||||..| .|.|||::|:...:::||||. 
Mouse     3 ALLFLALVGAAVAFPVDDDDKIVGGYTCRENSVPYQVSLNSG-YHFCGGSLINDQWVVSAAHCY- 65

  Fly    76 EYSKPQYYVIRAGSSDWT--KGG-SYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRP 137
               |.:..| |.|..:..  :|. .:|...|||.||.|:..| :||||.:::|..|:..:..:..
Mouse    66 ---KTRIQV-RLGEHNINVLEGNEQFIDAAKIIKHPNFNRKT-LNNDIMLIKLSSPVTLNARVAT 125

  Fly   138 ISLATSKDIIMPT-AQLFVSGWGST-SISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMF 200
            ::|.:|   ..|. .|..:||||:| |....:|: .|:.....|..|..|..:|  .|.:|..|.
Mouse   126 VALPSS---CAPAGTQCLISGWGNTLSFGVSEPD-LLQCLDAPLLPQADCEASY--PGKITGNMV 184

  Fly   201 CAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTI 263
            |||...||:||||||||||:|  .:|.|:  ||||||:|||....||:||||..|.|||..||
Mouse   185 CAGFLEGGKDSCQGDSGGPVV--CNGELQ--GIVSWGYGCALPDNPGVYTKVCNYVDWIQDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 92/232 (40%)
Tryp_SPc 32..262 CDD:238113 94/234 (40%)
Prss1NP_444473.1 Tryp_SPc 23..239 CDD:214473 92/232 (40%)
Tryp_SPc 24..242 CDD:238113 94/234 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.