DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13430 and LOC100485189

DIOPT Version :9

Sequence 1:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:241 Identity:85/241 - (35%)
Similarity:118/241 - (48%) Gaps:25/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSD---W 92
            ||:||.|......|...||....:|.|||.:|..|.:||||||.|...:     :|.|..:   :
 Frog    21 RIIGGTECRPNSQPWHCSLYYFDQHVCGGVLIDENWVLTAAHCQLSSLQ-----VRLGEHNLAVY 80

  Fly    93 TKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTA----QL 153
            .....:...:|:.||..| :|...:|||.:::|..|:..:..::.|.|.      .||.    ..
 Frog    81 EGKEQFSYAEKMCPHSGF-NPITFDNDIMLLKLVSPVTINDYVQTIPLG------CPTVGDGETC 138

  Fly   154 FVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGG 218
            .|||||:|:..:......|:...|....|:.| :..|....:|:.|.|||...||:|||||||||
 Frog   139 LVSGWGTTTSPEETFPDELQCVEVQTVSQDYC-QGAFPTDEITDNMLCAGVMEGGKDSCQGDSGG 202

  Fly   219 PLVTSIDGRLKLYGIVSWG-FGCANAMFPGIYTKVSAYDDWIAQTI 263
            |||.:    ..::||.||| ..|..|..||||||:..|..||..||
 Frog   203 PLVCN----SMVHGITSWGNTPCGVANKPGIYTKICNYIAWIQDTI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 81/235 (34%)
Tryp_SPc 32..262 CDD:238113 82/237 (35%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 82/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000102
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.